Basic Information | |
---|---|
Taxon OID | 3300027775 Open in IMG/M |
Scaffold ID | Ga0209177_10155265 Open in IMG/M |
Source Dataset Name | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 780 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil → Agricultural Soil Microbial Communities From Utah And Georgia To Study Nitrogen Management |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Georgia | |||||||
Coordinates | Lat. (o) | 33.8834 | Long. (o) | -83.4195 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F049089 | Metagenome | 147 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0209177_101552651 | F049089 | N/A | WRMIPALFGHSNLLFAPMHVDDFGRRAAELIQQHHNGRRIETVCGPEDLSGMVLAYRIARRYRSVPIPLWWPAVAVGLKALHKIGFAIVKPDQLTRLVSEKTGTAATTKTTTAMSRRFLSASGKSRER |
⦗Top⦘ |