Scaffold Ga0207421_10051213

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0207421_10051213

Scaffold Ga0207421_10051213

Overview

Basic Information
Taxon OID	3300027784 Open in IMG/M
Scaffold ID	Ga0207421_10051213 Open in IMG/M
Source Dataset Name	Alkaline sediment microbial communities from Lake Tanatar, Kulunda Steppe, Russia - 8KL_010_SED (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2654
Total Scaffold Genes	7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	7 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Sediment → Alkaline Sediment → Alkaline Sediment Microbial Communities From Soda Lakes And Soda Solonchak Soils

Source Dataset Sampling Location
Location Name	Russia: Kulunda Steppe, Lake Tanatar
Coordinates	Lat. (^o)	51.39	Long. (^o)	79.48	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F066493	Metagenome	126	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0207421_100512134	F066493	GGAGG	MSKHHREFDDSLIDVADELVARHTAEGAIERLQRRRQTTNDELALRCTEAIAWIKRERLDDES

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.