NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209246_10113027

Scaffold Ga0209246_10113027


Overview

Basic Information
Taxon OID3300027785 Open in IMG/M
Scaffold IDGa0209246_10113027 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1066
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location NameLake Michigan, USA
CoordinatesLat. (o)43.1998Long. (o)-86.5698Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001326Metagenome / Metatranscriptome721Y
F008184Metagenome / Metatranscriptome337Y
F035758Metagenome / Metatranscriptome171Y

Sequences

Protein IDFamilyRBSSequence
Ga0209246_101130271F035758N/AEFYESIRGLMSVEQPSVLGRNMSFHGYVSTFAAISGMIRKITQA
Ga0209246_101130272F001326GAGMATYTVTNKYLIDNFAVLQLLTPSEIAVGSSITVASVDATFNGTYTVRALPQYLFLGVDTQGDLLYDYQIPIADQVLYAKTASDVERVAASGTVTYEPVCTWVTAAQVMSYLGITITNPSDDYTLLTQSVSAGNQFCYRRRQESGYIDSLTTSPGGDATLGTLMYCAALWRSRGSIEATYATFDGMGSAPQQSLTPIVKQLLGIPRPAVA
Ga0209246_101130273F008184N/AMSYTDLFNEAIDDVTATLTAVSGLRVVNDPTKLVPNCVYLDAPNFTTFAGNGNIVRLEFPIKVIGSGPAGLPVLRSILSIVASVLGSSIIVM
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.