NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209711_10038354

Scaffold Ga0209711_10038354


Overview

Basic Information
Taxon OID3300027788 Open in IMG/M
Scaffold IDGa0209711_10038354 Open in IMG/M
Source Dataset NameMarine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2742
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean

Source Dataset Sampling Location
Location NameArctic Ocean: Canada Basin
CoordinatesLat. (o)79.2466Long. (o)-150.0613Alt. (m)Depth (m)25
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005796Metagenome / Metatranscriptome390Y
F025150Metagenome / Metatranscriptome203Y
F062792Metagenome / Metatranscriptome130N

Sequences

Protein IDFamilyRBSSequence
Ga0209711_100383542F062792AGAAGGMTPQERMTHKRRWRMASHFVYHTHTDLRSESKEWCKKNCEQHEWDLKQFTDIYGDTIRFEFEEHFNEFSNWYNARWSGV
Ga0209711_100383544F025150GGAGMIKVTTEGKRFPEYDTFIDECIIALFPENAVYDINIRFKKFADKTGTHAGFCEGDDIESAIIVGTHWKYEDNEVIAYEPHEIASSLAHELTHAKQFCKNQINMIDHVWKHASETIDCVELEYAETPWEVEAYAYEEILTDLLWENV
Ga0209711_100383546F005796GGAGMLVVELAVLMFCMIGCGMTCHALGKQEGIETTIEHLVDHGMLELEDEK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.