NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209972_10073300

Scaffold Ga0209972_10073300


Overview

Basic Information
Taxon OID3300027793 Open in IMG/M
Scaffold IDGa0209972_10073300 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1785
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From Lake Erie, Under A Cyanobacterial Bloom.

Source Dataset Sampling Location
Location NameUSA: Ohio, Lake Erie
CoordinatesLat. (o)41.69957Long. (o)-83.2941Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002827Metagenome / Metatranscriptome527Y
F005146Metagenome / Metatranscriptome410Y
F016263Metagenome / Metatranscriptome248Y

Sequences

Protein IDFamilyRBSSequence
Ga0209972_100733003F016263GAGGMPKCGVCGWSFSDRTLIKHAETPCGEESEKAGRMSYAPEIDDLIRQEEESK
Ga0209972_100733005F002827AGGAGGMNKEYYQAKADLCQKLAVEAMTEGDSKTAGDNLIRMVNALNQLNLINYQEEKNNG
Ga0209972_100733008F005146AGGMKLINFYEVMNYKGDIEWGGARASEAIKWFRKGFNNSIFVSVWNEEDIEEPVLVTDKIEVTNLLLSLLVSEREEYQPKPKKEWAR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.