NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209107_10026354

Scaffold Ga0209107_10026354


Overview

Basic Information
Taxon OID3300027797 Open in IMG/M
Scaffold IDGa0209107_10026354 Open in IMG/M
Source Dataset NameFreshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3343
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (33.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment → Freshwater And Sediment Microbial Communities From A Dead Zone In Lake Erie, Usa

Source Dataset Sampling Location
Location NameLake Erie, Canada
CoordinatesLat. (o)41.77Long. (o)-81.73Alt. (m)Depth (m)20
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F037116Metagenome / Metatranscriptome168N
F078232Metagenome / Metatranscriptome116N
F097235Metagenome / Metatranscriptome104N

Sequences

Protein IDFamilyRBSSequence
Ga0209107_100263541F037116N/AMEPTNNGSTSPGLSLAAAAGATAASFLPILTDWVRLVTAVVGLLCACYGAYRLFKSK
Ga0209107_100263545F078232AGGAGGMPVLTPQELADTGGCFDCMMPVLQQTMLLSLLQQIQVASFDAARTTASPGGLLTATATAAANPGRRRFVIQNQKNEELFVKFGTGATLSSFHIVLPAHNTGAKHSDPFVFEGYTGAISVIPASGSPSYTFSEFI
Ga0209107_100263546F097235AGGAMYGQMMGKRKMDGMGRMSSEVETIEFQPPKELKLDGESGSAMVEWRMTPSGTVEIVAFDGVTLGEKGPVDMAEDSAEMEMDDMEEEA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.