Basic Information | |
---|---|
Taxon OID | 3300027803 Open in IMG/M |
Scaffold ID | Ga0209910_10043318 Open in IMG/M |
Source Dataset Name | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 712S3S |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 532 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → Holophagales → Holophagaceae → unclassified Holophagaceae → Holophagaceae bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost → Thawing Permafrost Microbial Communities From The Arctic, Studying Carbon Transformations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Sweden: Kiruna | |||||||
Coordinates | Lat. (o) | 68.3533 | Long. (o) | 19.0475 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F021601 | Metagenome / Metatranscriptome | 218 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0209910_100433182 | F021601 | GAG | MRIPHYRDLWRFRAPLSADEIRRTERWLATARVALTSAALFALWMEPARGFAHSPWLYWLLTVYLVHLSLIHI |
⦗Top⦘ |