NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209910_10047878

Scaffold Ga0209910_10047878


Overview

Basic Information
Taxon OID3300027803 Open in IMG/M
Scaffold IDGa0209910_10047878 Open in IMG/M
Source Dataset NameThawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 712S3S
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)519
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost → Thawing Permafrost Microbial Communities From The Arctic, Studying Carbon Transformations

Source Dataset Sampling Location
Location NameSweden: Kiruna
CoordinatesLat. (o)68.3533Long. (o)19.0475Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F103723Metagenome / Metatranscriptome101Y

Sequences

Protein IDFamilyRBSSequence
Ga0209910_100478781F103723N/ASSAAKMVHNRGPAKVDNNLPIRHQRGVMGPTYDPYALGHDGSVNTLRVTRQTRLSKPKPPAKTAPDVTEVVHVLVADSGPIQSQLLTRALKCRRDFQVSAVALEASALHKFLQSNQADVILIAGNHLPDLGLLRWLRLSYPKVAPLLLAESDDRELVVLSLIHI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.