NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209358_10015910

Scaffold Ga0209358_10015910


Overview

Basic Information
Taxon OID3300027804 Open in IMG/M
Scaffold IDGa0209358_10015910 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4855
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (46.15%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Enterococcaceae → Enterococcus(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location NameLake Michigan, USA
CoordinatesLat. (o)43.1998Long. (o)-86.5698Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F019996Metagenome / Metatranscriptome226Y
F022646Metagenome213N

Sequences

Protein IDFamilyRBSSequence
Ga0209358_1001591011F019996AGGMASKCIFCKREMNNKLEQHIKACHKCIVDLLMKKHNLKVKKQAPVKLNLKKYE
Ga0209358_100159102F022646N/AVQIAKANIIHSVKHQKFVASFPCVVCGNDTQVQCCHIRSIPKVGNVGKGIRDDRFCIPMCFTCHTQQHLIGELEFFQKYNINPILISMKIASISPCNKINQAKQEGAYNGKLNYQEHIRNNKKSSLQS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.