NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209358_10313592

Scaffold Ga0209358_10313592


Overview

Basic Information
Taxon OID3300027804 Open in IMG/M
Scaffold IDGa0209358_10313592 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)766
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED203(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location NameLake Michigan, USA
CoordinatesLat. (o)43.1998Long. (o)-86.5698Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013409Metagenome / Metatranscriptome271N
F098928Metagenome / Metatranscriptome103N

Sequences

Protein IDFamilyRBSSequence
Ga0209358_103135921F098928AGGMKEKIKQVNDLCAANGTYLNQHGKKTVSAWSKIKYFREVFGTEFGINCVIQEHSDRYVIMKCIITKSDPEHIVATGY
Ga0209358_103135922F013409N/AMKVILIIIMMNGTVYNLGFNLNHYDARTCDKLFDSVTYSGKTSGKNKHGSFYKSKEIFAYSCTLEKTTKGNNERKNKTS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.