NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209229_10176809

Scaffold Ga0209229_10176809


Overview

Basic Information
Taxon OID3300027805 Open in IMG/M
Scaffold IDGa0209229_10176809 Open in IMG/M
Source Dataset NameFreshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)958
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment → Freshwater And Sediment Microbial Communities From A Dead Zone In Lake Erie, Usa

Source Dataset Sampling Location
Location NameSandusky Bay, Ohio, USA
CoordinatesLat. (o)41.474889Long. (o)-82.854137Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000263Metagenome / Metatranscriptome1424Y
F000868Metagenome / Metatranscriptome853Y
F013184Metagenome / Metatranscriptome273Y
F063705Metagenome / Metatranscriptome129Y

Sequences

Protein IDFamilyRBSSequence
Ga0209229_101768091F000868N/AMIIDAEYSYIGEQLVEDWVNSNLNEGQLYADYCFAEMCESNYLKGRFNLFYDLNAGDQYYIEWDEEL
Ga0209229_101768092F013184GGAMKKYPFVIRLEGAVMADNEKQAHYKINQHLNDLGDVDSARYDLNWPDVSWDMEYDLC
Ga0209229_101768094F063705GGAGGLTKSSVFLEYMKLHLISLNQDWEAAKNGEPLAEDEYDPSDDYFEGAIAATEHLLSVATDIMNSTSERYE
Ga0209229_101768095F000263AGGMNQEDIGLPPHLQRLVNAGVSGLDIMHGELKNLMLMAEQELAFAIEREEQTEEAMDSMLRTEAEGVLDTLVSLYDL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.