NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209090_10011214

Scaffold Ga0209090_10011214


Overview

Basic Information
Taxon OID3300027813 Open in IMG/M
Scaffold IDGa0209090_10011214 Open in IMG/M
Source Dataset NameMarine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5393
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (28.57%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Eukaryota(Source: Euk_MAG)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean

Source Dataset Sampling Location
Location NameArctic Ocean: Canada Basin
CoordinatesLat. (o)73.2247Long. (o)-150.2247Alt. (m)Depth (m)67
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017048Metagenome / Metatranscriptome243Y
F031650Metagenome / Metatranscriptome182Y

Sequences

Protein IDFamilyRBSSequence
Ga0209090_100112144F017048N/AMSSNFNYEPSKSSLRADTVVEFVNRSLLDFKINEIPGMGPASISKFSDHGIYTPAQIVAKFLSYVDSHETTGQQVCESFYNWANPIMGKANTHNLTFALANYCSEHGLFSLDD
Ga0209090_100112146F031650N/AMDNQMDSMTQEEFDELKLAYQESVPAGDALKEQLKSHNKEQKTRLNQIHAYMRENNIMSADIGGITIEREEKTTVSVSMKTLEEVIDNPADLEQYKRDHTTTKEVLKVRKPKRRRTSDE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.