NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209990_10407304

Scaffold Ga0209990_10407304


Overview

Basic Information
Taxon OID3300027816 Open in IMG/M
Scaffold IDGa0209990_10407304 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)590
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From Lake Erie, Under A Cyanobacterial Bloom.

Source Dataset Sampling Location
Location NameUSA: Ohio, Lake Erie
CoordinatesLat. (o)41.69957Long. (o)-83.2941Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010307Metagenome / Metatranscriptome305Y
F023806Metagenome / Metatranscriptome208Y

Sequences

Protein IDFamilyRBSSequence
Ga0209990_104073042F010307GGAGMENVTFIEIEMPNGTETHAIIDRGNGEFTSMLKSTYDAMQAEQSTPIVTADE
Ga0209990_104073043F023806N/AMSNYPQGTNARLIEVAAAEVGTIEEGDNLTKYGKFTKADGLPWCG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.