NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209633_10005606

Scaffold Ga0209633_10005606


Overview

Basic Information
Taxon OID3300027822 Open in IMG/M
Scaffold IDGa0209633_10005606 Open in IMG/M
Source Dataset NameOil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 1 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)10974
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)13 (81.25%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine → Marine Microbial Communities From The Santa Barbara Channel Oil Seeps

Source Dataset Sampling Location
Location NameCoal Oil Point, Santa Barbara, CA
CoordinatesLat. (o)34.39225Long. (o)-119.845662Alt. (m)Depth (m)47
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004928Metagenome / Metatranscriptome418Y
F005564Metagenome / Metatranscriptome396Y
F051143Metagenome / Metatranscriptome144Y

Sequences

Protein IDFamilyRBSSequence
Ga0209633_1000560612F051143GGAMHESMRIEELERIKTMTTLEAVAYANRLSNRLKSDDCTDKEKQNGVELLGRLANRVSFLKITLEPPTFCQLGWKYFAESGGAYK
Ga0209633_1000560614F005564GGAGMHKLIIGLMVIFFLGDPGLQTLAWLGEMKTYLVAAAIALVSIPFVVSQLDG
Ga0209633_100056063F004928AGGAGMGQALHSIENEPEHTVEIVVHITETLGEQRREDLVASLEGNGGITTAEFCPLRYHLMLVRYDRDLYSSQDVLDRVTSQNVNARLIGPV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.