NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209060_10008431

Scaffold Ga0209060_10008431


Overview

Basic Information
Taxon OID3300027826 Open in IMG/M
Scaffold IDGa0209060_10008431 Open in IMG/M
Source Dataset NameSurface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6507
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (76.92%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil → Surface Soil Microbial Communities From Centralia Pennsylvania, Which Are Recovering From An Underground Coalmine Fire.

Source Dataset Sampling Location
Location NameUSA: Pennsylvania, Centralia
CoordinatesLat. (o)40.7999Long. (o)-76.3402Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000065Metagenome / Metatranscriptome2788Y
F008377Metagenome / Metatranscriptome334Y
F075195Metagenome / Metatranscriptome119Y

Sequences

Protein IDFamilyRBSSequence
Ga0209060_100084311F008377AGGMDEAKSQPWYQLCAAAVVELDPKKLIERVDAAEAAIHGRLRDLQYDSDHHEERQLMADAQRTL
Ga0209060_100084313F075195GAGMQMCSDSCAKIKDLGFTASTHIKMYGERFEIVSDPFDEGDCIAVRALRGNDPEIRTLRLPVAILVRREDRFLKR
Ga0209060_100084316F000065N/AMSRIKRLIPKLRKAPQPPLSHPGAPAEADRAKRPPLDQPTVHDSELNPGDRVEGLADFGKLTGEFGTVEKTNEDDALVKWDDDGRTRLHQPWLKKVSGKAHAQSGPASS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.