NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209035_10019085

Scaffold Ga0209035_10019085


Overview

Basic Information
Taxon OID3300027827 Open in IMG/M
Scaffold IDGa0209035_10019085 Open in IMG/M
Source Dataset NameMarine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - AAIW_A/KNORR_S2/LV (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3180
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Affecting The Dissolved Organic Carbon Pool

Source Dataset Sampling Location
Location NameSouth Atlantic Ocean
CoordinatesLat. (o)-37.9831Long. (o)-44.9892Alt. (m)Depth (m)754
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007121Metagenome / Metatranscriptome357Y
F025588Metagenome / Metatranscriptome201N

Sequences

Protein IDFamilyRBSSequence
Ga0209035_100190853F007121N/AMLKTFLLTLFLSLGVATPVSGGWVIVLQDELQEPTLDKLIDWIPEEVPRTVSFYFDTDADGKFDIKIAYSLIEAFPCRKNCVSKITDKGDHWLLPAPGINYYVIKKWIMYRYFDDESWRGAITTNDWIFENPLYEDWLEHEYYPLWPEQRMK
Ga0209035_100190857F025588GAGGMKSYTQFRIELAEDEMMHGEPGTENPSTTIHYGPNDPEIVRTASITMTVPKYRLSEDEKGCNFTCSHWRDQTYCNEYKFKCDEDYICDSWSDSGI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.