Basic Information | |
---|---|
Taxon OID | 3300027836 Open in IMG/M |
Scaffold ID | Ga0209230_10787254 Open in IMG/M |
Source Dataset Name | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 517 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment → Freshwater And Sediment Microbial Communities From A Dead Zone In Lake Erie, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Canada: Lake Ontario | |||||||
Coordinates | Lat. (o) | 43.933506 | Long. (o) | -78.003845 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F071974 | Metagenome / Metatranscriptome | 121 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0209230_107872541 | F071974 | N/A | MSPVLPTAHERCGKMETLEKDGSKPLSFDGKAASWPPFKKKLHQLLDKEGCGWVVEGGNAFCAMLQAASAKAANITTTSGKGIVSTNVADYKEKELQAAFSSATVTTSVLLELIACRKTVLGARIMQTTRNSA |
⦗Top⦘ |