NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209089_10011270

Scaffold Ga0209089_10011270


Overview

Basic Information
Taxon OID3300027838 Open in IMG/M
Scaffold IDGa0209089_10011270 Open in IMG/M
Source Dataset NameMarine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6785
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (56.25%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → unclassified Nitrososphaerales → Nitrososphaerales archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean

Source Dataset Sampling Location
Location NameArctic Ocean: Canada Basin
CoordinatesLat. (o)73.2247Long. (o)-150.2247Alt. (m)Depth (m)177
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000615Metagenome / Metatranscriptome984Y
F001048Metagenome / Metatranscriptome793Y
F002874Metagenome / Metatranscriptome524Y
F010791Metagenome / Metatranscriptome299N

Sequences

Protein IDFamilyRBSSequence
Ga0209089_1001127010F000615GAGMCRIRCFYECSDGKMGFAEMVVSYDEDIAGLIRHWGTGGRMVITEHVDLV
Ga0209089_1001127013F010791GAGMSFEFRAGRKRVVKTVETVEEANKLMRKMIAIRNENFLWENIDVKTGHLRAVDELEKVMGAIFDVFNTMSIYVNGKSVRRIWSRGF
Ga0209089_1001127014F002874GAGMEEKIDLSLNRSLSELESSYWEFTEETEGEDSSEWSGSVQEDFSALEGYLMKMDIL
Ga0209089_1001127016F001048N/AMKIKSKKHFWWRFNHLKRNGGEIIVTDRTPEMDVKDFNRIELLVNKRVRWEIGSEGMAIWNACGVKDIPTLAKAYGIK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.