NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209517_10000467

Scaffold Ga0209517_10000467


Overview

Basic Information
Taxon OID3300027854 Open in IMG/M
Scaffold IDGa0209517_10000467 Open in IMG/M
Source Dataset NamePeat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)68342
Total Scaffold Genes60 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)41 (68.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil → Peatlands Soil Microbial Communities From Germany And Austria, That Are Sulfate Reducing

Source Dataset Sampling Location
Location NameGermany: Weissenstadt
CoordinatesLat. (o)50.13Long. (o)11.88Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000209Metagenome / Metatranscriptome1592Y
F000359Metagenome / Metatranscriptome1236Y

Sequences

Protein IDFamilyRBSSequence
Ga0209517_1000046718F000209GGGGGMAFAQNWGSEQSSVVLRLNHRLTLGLIGVGVIFASLGLGEAVYRFAFLDFDGATDRLPIEMLFGLAFAWMTTKLAKRIYQYRMETSARINLIRDRNSRIRHAVEAIKPVPYPSNQQAIRVIREEVDRIERVLTEIISQ
Ga0209517_1000046736F000359GGAGMAGQVILYFDDQADALRFALAAGSVMAGDATRATGDLVQETARVTRIRLDAANKEKGKQPNPPERAA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.