NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209166_10000017

Scaffold Ga0209166_10000017


Overview

Basic Information
Taxon OID3300027857 Open in IMG/M
Scaffold IDGa0209166_10000017 Open in IMG/M
Source Dataset NameSurface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)276811
Total Scaffold Genes276 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)210 (76.09%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil → Surface Soil Microbial Communities From Centralia Pennsylvania, Which Are Recovering From An Underground Coalmine Fire.

Source Dataset Sampling Location
Location NameUSA: Pennsylvania, Centralia
CoordinatesLat. (o)40.7999Long. (o)-76.3402Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001194Metagenome / Metatranscriptome750Y
F042487Metagenome / Metatranscriptome158N
F047241Metagenome / Metatranscriptome150Y
F057553Metagenome / Metatranscriptome136Y

Sequences

Protein IDFamilyRBSSequence
Ga0209166_10000017156F047241N/AMKESKANSGLLRALALSHEMFAAAERGDLRSVELLDAERLELLKCFRLETKVVNAAADRALLQQISQLNDRAIGLLEHQRRSKGREMDMAAVGRRAMAAYSSIRLQR
Ga0209166_10000017227F001194N/AMSVRRVLLGTLAGLGAIIGYGCLLVFLYLVGTQAYRFFREGEWMHVGMGDGIRFGLVHCCVKEGAGGKLAVFLQWWESPATWLGLHKVFEVIPASLALFAVSMVGNSLFIYCRDRLQQR
Ga0209166_10000017253F042487AGAAGGMNKWSSVAVSAALLVAGVGASVSAEAHPYLTVGIDVPPVAVVGPFGHALVYCGPYCYEHGRYWRRDYDRYRFDRFPRERWYRR
Ga0209166_1000001799F057553GAGGMSEVDRVSNSGLYPALPIADRRGSNDDKERRQHSDKGPDKPAAKSTDTPGAPRPPKSQIDEYA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.