NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209611_10004315

Scaffold Ga0209611_10004315


Overview

Basic Information
Taxon OID3300027860 Open in IMG/M
Scaffold IDGa0209611_10004315 Open in IMG/M
Source Dataset NameHost-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)24394
Total Scaffold Genes25 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)13 (52.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → unclassified Enterobacter cloacae complex → Enterobacter cloacae complex sp. GF14B(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated → Host-Associated Microbial Communities From Peat Moss Sphagnum Species From Minnesota, Usa

Source Dataset Sampling Location
Location NameUSA: Minnesota
CoordinatesLat. (o)47.5028Long. (o)-93.4828Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002736Metagenome / Metatranscriptome533Y
F004020Metagenome456Y
F069606Metagenome / Metatranscriptome123Y

Sequences

Protein IDFamilyRBSSequence
Ga0209611_1000431519F004020N/AMEDHKKMFSTQILIEVEVEVVKFHFEVHTKVRMVDIINIKVKLMEVNEETLEEKEVKEVVEVVVEVIKVNNQITIQIVITAGNLGTWRRIVIKGNMMHEMESYNKGIMHQLVIKVMSNYL
Ga0209611_1000431521F002736GGAGMPSIFTQNFNSIDGNHKKLSLSKGTYFKIAIETLNAWISLNTDPNDMKFLQYIYSFMIYMIPKLQIQKCSNKGDMTKKPDLAQSLQRLITLTKHILFV
Ga0209611_100043156F069606GAGGMLILEFDLILFKSLIEVKLNKDVLGLHPKNLTSTSLVLEDSSTY
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.