NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209611_10021059

Scaffold Ga0209611_10021059


Overview

Basic Information
Taxon OID3300027860 Open in IMG/M
Scaffold IDGa0209611_10021059 Open in IMG/M
Source Dataset NameHost-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7583
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (55.56%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida → Dicranidae → Pseudoditrichales → Ditrichaceae → Ceratodon → Ceratodon purpureus(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated → Host-Associated Microbial Communities From Peat Moss Sphagnum Species From Minnesota, Usa

Source Dataset Sampling Location
Location NameUSA: Minnesota
CoordinatesLat. (o)47.5028Long. (o)-93.4828Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F037022Metagenome / Metatranscriptome168Y
F085030Metagenome / Metatranscriptome111Y

Sequences

Protein IDFamilyRBSSequence
Ga0209611_100210593F037022GGAGGVFKSLVVKLKRASTIQNPTNSLSKATVPRAKVFLRNVRGVAFYAVPHAGSSNIAKYVNKLLRCNNRHHPGIMDNIQPWQRDMEQLSVDFDRIVTENEINVYAFCEGRRMEQAVRMCWMK
Ga0209611_100210594F085030GGAVCNVLNAEFWWQSDWPVHQLWPPPEGNRRTELDVVLFHGLQLTATDTSDAWSSTWTQRGHDDVCWPQEWLPFDLGEAVRIFSVSYNAHVVTSPHDHVSEIADNLFQTLINPRYKSRLFGYENAMLGQM
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.