NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209167_10000059

Scaffold Ga0209167_10000059


Overview

Basic Information
Taxon OID3300027867 Open in IMG/M
Scaffold IDGa0209167_10000059 Open in IMG/M
Source Dataset NameSurface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)135239
Total Scaffold Genes124 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)92 (74.19%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil → Surface Soil Microbial Communities From Centralia Pennsylvania, Which Are Recovering From An Underground Coalmine Fire.

Source Dataset Sampling Location
Location NameUSA: Pennsylvania, Centralia
CoordinatesLat. (o)40.7999Long. (o)-76.3402Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000238Metagenome / Metatranscriptome1494Y
F000359Metagenome / Metatranscriptome1236Y
F005062Metagenome / Metatranscriptome413Y

Sequences

Protein IDFamilyRBSSequence
Ga0209167_10000059123F005062N/AMGILDKVGFMKPNVARRVASICFLAACTLFSIESQPPSACAQAPAIRVQSSLVLVDVVSQDLKSGLSVRDFKKEDFHVFDNRHEVRIATFDAGADIRPITLWLVVICNEGGVVGGSAEFVGKESLFRSAMDHLEKHDTVGVAHWCDNGETQLDLLPTEDRDRPIGALAETLRPISFRGGTDASDQVGEETFREMIRLIIHDAYQRNPKPLPVIVFLHGDHTGQPRQELDKVIDDFLETSGIVFGIRDDQSAGLLFLIGEQAKILHYMAKHTGGQYFSAPPSGYAAALEVVLTQLHSRYELGFIPPAIDGKRHELKVELTKEAKAEHKRVRLRFRPEYIPVREEPEWAH
Ga0209167_1000005958F000359GGGGGMSRQVILYFDDQTDALRFALAAGSVMAGDGRNATDSLLQETARVTRIRLDAANAGKASKSSPPERAA
Ga0209167_1000005988F000238GGAMSPQRTIRSPRWYTIPIRVALVTFISTLLSFAVTLLFAILGTVITARLHGVHPDMRMAYRYIALPVAAVAGSIILVLALFMEIRHYRQSKTLAAIERLS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.