NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209283_10069134

Scaffold Ga0209283_10069134


Overview

Basic Information
Taxon OID3300027875 Open in IMG/M
Scaffold IDGa0209283_10069134 Open in IMG/M
Source Dataset NameVadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2272
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil → Vadose Zone Soil And Rhizosphere Microbial Communities From The Eel River Critical Zone Observatory, Northern California To Study Diel Carbon Cycling

Source Dataset Sampling Location
Location NameUSA: California, Eel River Critical Zone Observatory
CoordinatesLat. (o)39.7291Long. (o)-123.6419Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001681Metagenome / Metatranscriptome652Y
F001901Metagenome / Metatranscriptome620Y

Sequences

Protein IDFamilyRBSSequence
Ga0209283_100691344F001901GGAGGMTRRKQPWGEQRGWIVPADGSPPQELPPHMVGHKLISWPGTMPEKQPAEPVKDLASKNYYHRHVLNPEGVSVYVPEGRDAESLPESIKTEIRRQLRGQS
Ga0209283_100691345F001681N/ARLQRDPDGLFLWHPDYAPWIVGRRSLGANPNDRAFFDPTAGDIVWSSRDGMKDYEMDELAARHLVGELVEMPQCESEREVEDWFLERGFKVEWI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.