NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209293_10035616

Scaffold Ga0209293_10035616


Overview

Basic Information
Taxon OID3300027877 Open in IMG/M
Scaffold IDGa0209293_10035616 Open in IMG/M
Source Dataset NameWetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1937
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_46_12(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland → Wetland Microbial Communities From Old Woman Creek Reserve In Ohio, Usa

Source Dataset Sampling Location
Location NameOld Woman Creek National Estuarine Research Reserve, Ohio, USA
CoordinatesLat. (o)41.2239Long. (o)-82.3039Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018024Metagenome / Metatranscriptome237Y

Sequences

Protein IDFamilyRBSSequence
Ga0209293_100356163F018024GGAGGMKIAEGDRFKHKLTGQLYEVRIIKEDTFILESPETPYRMWFGEADLELFFEMAGKRKAAT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.