NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209635_10063359

Scaffold Ga0209635_10063359


Overview

Basic Information
Taxon OID3300027888 Open in IMG/M
Scaffold IDGa0209635_10063359 Open in IMG/M
Source Dataset NameMarine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3019
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment → Marine Sediment Microbial Communities From White Oak River Estuary, North Carolina

Source Dataset Sampling Location
Location NameWhite Oak River estuary, North Carolina, USA
CoordinatesLat. (o)34.640199Long. (o)-77.109447Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000645Metagenome / Metatranscriptome962Y
F005878Metagenome / Metatranscriptome387Y

Sequences

Protein IDFamilyRBSSequence
Ga0209635_100633592F005878GAGMHPFKCGNCKKITAQREIRRYASEIVEGADVWLMECQNCFEMRLIDPVERVAQKEDDITRCDQCGNYKMQAAKCRICQIAAGQERIKERYWTGGATLERFLDADI
Ga0209635_100633593F000645GGAGMSNWLEDYEGVWDRYEKFKKDFPDYRHKSHILAESLTAQSEVFIIKTELYRTWNDSEPFATGLSSEVKGKQYAVELCETGSLGRALQMAGYPAKPKGGNLPLKPIQTTKPELAEFVQEQRPNHPEPIVWDVSAVADQLGAEIIDEIPLCPGGDGPMVLKTGVKEGKEYRGWVCPTPKSGHPAKWMKIGADGSWYFPR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.