NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209635_10083504

Scaffold Ga0209635_10083504


Overview

Basic Information
Taxon OID3300027888 Open in IMG/M
Scaffold IDGa0209635_10083504 Open in IMG/M
Source Dataset NameMarine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2615
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (16.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment → Marine Sediment Microbial Communities From White Oak River Estuary, North Carolina

Source Dataset Sampling Location
Location NameWhite Oak River estuary, North Carolina, USA
CoordinatesLat. (o)34.640199Long. (o)-77.109447Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F030967Metagenome183Y
F104375Metagenome100Y

Sequences

Protein IDFamilyRBSSequence
Ga0209635_100835042F030967N/AMESEARNVNVEELKRLEEFEKRLNKLEAHGFEDTLTLVEILSSITFFGGLKMEKCKYAKEGQCGFFFLKNEAKKKIPMASDCRIKDCKGEPDHCHLELSNVTCAFCPKARIPRT
Ga0209635_100835043F104375N/AVGEPLNCPECHGALVFPNGLKGEIICKRCGLVMSRGQSSQGFTKWAPKWFSNWNENDSDTLREWLTTLRTVSCQLNLPDFPYREETARTIKLKSDMLFRSQRFGKNKREAIAALVHLVLRKYNEIRPLREICETLSLDHRLVTKYAWTMRKMTGFHRTFSPKDYLRKYGWKLTSNAELIQRAEQLLASLRNEISGNPVSLAAGAFYFVCKSRKMRMSKDEIGEAFHISGRTVYSNERRISRLMSTKSFGL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.