 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300027888 Open in IMG/M |
| Scaffold ID | Ga0209635_10575519 Open in IMG/M |
| Source Dataset Name | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 846 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment → Marine Sediment Microbial Communities From White Oak River Estuary, North Carolina |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | White Oak River estuary, North Carolina, USA | |||||||
| Coordinates | Lat. (o) | 34.640199 | Long. (o) | -77.109447 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F052014 | Metagenome | 143 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209635_105755191 | F052014 | AGGAGG | MERVPTTLYLWISRVAGFAGMVCIVIALVTGVTDSKLVAAPGTYVQIAIAAFLFAIWGVLYEI |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |