NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209380_10315932

Scaffold Ga0209380_10315932


Overview

Basic Information
Taxon OID3300027889 Open in IMG/M
Scaffold IDGa0209380_10315932 Open in IMG/M
Source Dataset NameWarmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)917
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil → Soil Microbial Communities From The Hubbard Brook Experimental Forest, New Hampshire, Under Manipulated Climate Change Conditions.

Source Dataset Sampling Location
Location NameUSA: New Hampshire, Hubbard Brook experimental Forest
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003851Metagenome / Metatranscriptome465Y
F015067Metagenome / Metatranscriptome257Y

Sequences

Protein IDFamilyRBSSequence
Ga0209380_103159321F015067N/AMSLLRLGICRPNDWSGSAVDFVEHGFRRFCSQNRAADVKRVWVGDLRITDCLFELTEQERNQLEAGKEDMSDHLYLVGDYEAAASIPIGATLARLEAENDLLPVAFYNVFATNLYKWMRVYDYLDAQEHAETWMEDLSTEELESSVYRKVDMEIPASIKRHSKAFKYRRAKALLREIRPRASVARELIRHLHE
Ga0209380_103159322F003851N/ADFRTIDEGAKRVVRALKAARHGCVNANDPIMEQLRQCPEAFKVGEILGKAFESVKYAQDGSEFRDRYLPPSGAVIPPLV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.