Scaffold Ga0209636_10002467

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209636_10002467

Scaffold Ga0209636_10002467

Overview

Basic Information
Taxon OID	3300027893 Open in IMG/M
Scaffold ID	Ga0209636_10002467 Open in IMG/M
Source Dataset Name	Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-52-54 (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	18846
Total Scaffold Genes	20 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	9 (45.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment → Marine Sediment Microbial Communities From White Oak River Estuary, North Carolina

Source Dataset Sampling Location
Location Name	White Oak River estuary, North Carolina, USA
Coordinates	Lat. (^o)	34.6478111	Long. (^o)	-77.1112083	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F069682	Metagenome	123	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209636_1000246715	F069682	GAGG	MMAKMKGEELERKLKRERVEACLNCKNFLKCEDIGKFEECADFAEVEDEAWVIRKT

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.