NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209068_10000010

Scaffold Ga0209068_10000010


Overview

Basic Information
Taxon OID3300027894 Open in IMG/M
Scaffold IDGa0209068_10000010 Open in IMG/M
Source Dataset NameFreshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)158668
Total Scaffold Genes153 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)118 (77.12%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds → Freshwater And Sediment Microbial Communities From Various Areas In North America, Analyzing Microbe Dynamics In Response To Fracking

Source Dataset Sampling Location
Location NamePennsylvania, USA
CoordinatesLat. (o)41.1289Long. (o)-78.4195Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000036Metagenome / Metatranscriptome4352Y
F007287Metagenome / Metatranscriptome354Y
F022762Metagenome / Metatranscriptome213Y
F039272Metagenome / Metatranscriptome164Y

Sequences

Protein IDFamilyRBSSequence
Ga0209068_1000001013F000036AGGCGGMAYKEVFWMACDSTEPLRAEYGPFHTRAEAEAEAQNLGFGYLLRYEHILGDDEEIQEVRCIFIERPGAVQPEDHSITLHTRCASCGESAAHEKSWQAEVWADIHEFEHSRHRVRLFEHVRGALKEIGGWRH
Ga0209068_1000001087F022762N/AMAKAKKFELDNPLPILDEEDEKTLAAIDEGVRDAKAGRTVPAEEVRKRLPKWITDSSTRKGR
Ga0209068_1000001088F007287GGAGGMSAKSSVAKALVVVGLLWASSALASADDHRYYESHSATQDFVAGGTLHVRMSVGDLHITRSSSNQLHLSYTIKSGKESRLKECSVDFNVHGNEADLEFHSPTPSNTSFDVELEVPENTRLDVHEKVGDLTVEKIDGDKDLELSVGNIRVADDHPSYRYVSASSSIGDVSGNGYGEGKGWLGKTLKYHGEGSYELRARVSVGDVTLEGK
Ga0209068_1000001099F039272N/AMKSIPLRAQLSLVVAGYAVVLATAAFLVYARYLLYVHQPDDVAASGGMYAAGDWMLEIFIGCMLLVPTFVLVLVIRKSEHLCVGYSRALLGLSLTAPICLGVLRIPAVGQGTMLLGWICMDRLFVSPIVIVGLVVSRLLARFDRAKRLTLYALLIEVLTLALTAVLFLFAARAH
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.