NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209668_10003223

Scaffold Ga0209668_10003223


Overview

Basic Information
Taxon OID3300027899 Open in IMG/M
Scaffold IDGa0209668_10003223 Open in IMG/M
Source Dataset NameFreshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7264
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (25.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment → Freshwater Lake Sediment Microbial Communities From The University Of Notre Dame, Usa, Of Lakes That Contribute To Methane Emissions

Source Dataset Sampling Location
Location NameUniversity of Notre Dame, Indiana, USA
CoordinatesLat. (o)41.7Long. (o)-86.23Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001272Metagenome / Metatranscriptome733Y
F012040Metagenome / Metatranscriptome284N
F026825Metagenome / Metatranscriptome196N

Sequences

Protein IDFamilyRBSSequence
Ga0209668_1000322310F001272N/AMIKIELTTEQANNLLQLIDISIKAGGFQNAKVGVPLAEIILEAAKANAPQQESAN
Ga0209668_100032235F012040AGGAMINWLRGLKKENPKNLLELPDINLSDWQTDGQQAELAQILNMPVLRMALRIVAESMPVPMPSHGSKESDIIFAAGVTAGYAHCLENLRKLAVTETAKEPEATFDKQY
Ga0209668_100032239F026825N/AMTDHHAFIRDISIGVGGPAIGILGNAVFSDPHLKTASLALGAIAALLTCAVKAVELYRKLKNDK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.