NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209253_10525128

Scaffold Ga0209253_10525128


Overview

Basic Information
Taxon OID3300027900 Open in IMG/M
Scaffold IDGa0209253_10525128 Open in IMG/M
Source Dataset NameFreshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)879
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment → Freshwater Lake Sediment Microbial Communities From The University Of Notre Dame, Usa, Of Lakes That Contribute To Methane Emissions

Source Dataset Sampling Location
Location NameUniversity of Notre Dame, Indiana, USA
CoordinatesLat. (o)41.7Long. (o)-86.23Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006503Metagenome / Metatranscriptome371N
F025272Metagenome / Metatranscriptome202N
F034851Metagenome / Metatranscriptome173N

Sequences

Protein IDFamilyRBSSequence
Ga0209253_105251281F034851N/ALLDDLWAIAQSEMDSWAKDGAFPYDKELLNLLMQTGNMKAMSRETGIPYRSIIYSIEQAKAKIKTAIESNGYTGFSNPD
Ga0209253_105251282F025272GAGMDILVFPILISALATLAVVEFRVLPGWFYALPFAKRKPFSCMTCFGFWLTVALTLPTCQWYLAPILGLASSATAILLREWTFK
Ga0209253_105251283F006503GGAMTNDQFVIAQKHRKYWDQYIASLTMRLPPDAVGELQAILTAHGRPPTNWWCADCVKSALQYIYLQADLFAESNQNTVTIPLSNAPANPEQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.