NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209415_10000387

Scaffold Ga0209415_10000387


Overview

Basic Information
Taxon OID3300027905 Open in IMG/M
Scaffold IDGa0209415_10000387 Open in IMG/M
Source Dataset NamePeat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)80224
Total Scaffold Genes72 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)56 (77.78%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil → Peatlands Soil Microbial Communities From Germany And Austria, That Are Sulfate Reducing

Source Dataset Sampling Location
Location NameGermany: Weissenstadt
CoordinatesLat. (o)50.13Long. (o)11.88Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002916Metagenome / Metatranscriptome521Y
F045236Metagenome / Metatranscriptome153Y

Sequences

Protein IDFamilyRBSSequence
Ga0209415_1000038711F045236GGGGGMAAKTPKILLIAASPMGMSFLAARLKKWACEIHFASSCKEANAFVGNQRFDLVLSEFRLWDGSPYPLAASLIGSSTTLVYSYPVETGCWWLPAVKNGQSCWGSLAMRPSEFIGFLDEILNEIRSRQTASSDEVSERLFKVMAK
Ga0209415_100003878F002916GAGGMQYLPGWTVQCLTPECPARGHWLRVEGLPQEICSNCGAPLHNVPPPLAPRFRMRPRPLASYRPARRPR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.