NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209404_10012058

Scaffold Ga0209404_10012058


Overview

Basic Information
Taxon OID3300027906 Open in IMG/M
Scaffold IDGa0209404_10012058 Open in IMG/M
Source Dataset NameMarine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4725
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (71.43%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location
Location NameTropical Atlantic Ocean
CoordinatesLat. (o)15.249Long. (o)-20.515Alt. (m)Depth (m)55
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007946Metagenome / Metatranscriptome342Y
F008525Metagenome / Metatranscriptome332Y

Sequences

Protein IDFamilyRBSSequence
Ga0209404_100120584F008525AGGAGMKTFKESFNEVLEAKLKLPKGEKVAKELTKLGRKKKTTAVITSKFNLYIDGIKLDKYKSVKAAEEGLKDFINLMGA
Ga0209404_100120585F007946N/AMSTRNLIDNIKKGDAQKSNNVFNSIMQDKILNALDTHKQEVASKMYGASDDTPVAEEPAVETPEGEEATDENV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.