NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209536_100027464

Scaffold Ga0209536_100027464


Overview

Basic Information
Taxon OID3300027917 Open in IMG/M
Scaffold IDGa0209536_100027464 Open in IMG/M
Source Dataset NameMarine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7806
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (78.57%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment → Marine Sediment Microbial Communities From White Oak River Estuary, North Carolina

Source Dataset Sampling Location
Location NameWhite Oak River estuary, North Carolina, USA
CoordinatesLat. (o)34.640199Long. (o)-77.109447Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F069851Metagenome / Metatranscriptome123N
F075861Metagenome / Metatranscriptome118N
F088537Metagenome / Metatranscriptome109Y

Sequences

Protein IDFamilyRBSSequence
Ga0209536_10002746411F088537AGGTGGMSTGPWEGGKGSRPRKYNISKYLDNYERIFGNATKERKEQEGNQPEHQDRDGGGKATESSDSNSYVKGEK
Ga0209536_1000274645F069851GGAGMDFVKDAIDANLDNLIDHKNRCVEATDAAANEVVIAWTEENPHDLQEWMFNDSPASVWEAFQVDMAKAFAGKMSHDDFFIKYSHYFDIAKRDIMEDLDSKIWNRYTDLHDVPVLDIYDYNGVRREDF
Ga0209536_1000274646F075861GGAGGMWSLARNGERFGYCAKDKKGIDKYRGWYIDDHVVSEAAIIQQRLWEKSKSSILQSEAEKVARETLEEQITVVEVNG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.