NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209536_100993163

Scaffold Ga0209536_100993163


Overview

Basic Information
Taxon OID3300027917 Open in IMG/M
Scaffold IDGa0209536_100993163 Open in IMG/M
Source Dataset NameMarine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1035
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment → Marine Sediment Microbial Communities From White Oak River Estuary, North Carolina

Source Dataset Sampling Location
Location NameWhite Oak River estuary, North Carolina, USA
CoordinatesLat. (o)34.640199Long. (o)-77.109447Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015083Metagenome257N
F026887Metagenome / Metatranscriptome196N

Sequences

Protein IDFamilyRBSSequence
Ga0209536_1009931632F015083AGGAGMASRSAVLANALVTAISGWASLPAGVTVARVRSVTHLLVDMPTASVGRVAVIVSSVEDQSNRGDVAEDVTIGIVVIGNCDSEAVAQSDSWDEFTEDLRDWLRTDATFKTIDLGGNLGAQRKTVSTLTVADADMLDESEIFVSVTEGVWFLSVGARS
Ga0209536_1009931633F026887N/AAARAASQSVRGESVTFSRGAYSLTLTAVRGSTGWDRSAPYGGVRIGDRSTDWICEAADLVDSNGDEIKPQRQDEIAVGGVTFRVMPYGPDNQLWMFHDRDRRYIRIHTKERV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.