NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209536_101180609

Scaffold Ga0209536_101180609


Overview

Basic Information
Taxon OID3300027917 Open in IMG/M
Scaffold IDGa0209536_101180609 Open in IMG/M
Source Dataset NameMarine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)939
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment → Marine Sediment Microbial Communities From White Oak River Estuary, North Carolina

Source Dataset Sampling Location
Location NameWhite Oak River estuary, North Carolina, USA
CoordinatesLat. (o)34.640199Long. (o)-77.109447Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000325Metagenome / Metatranscriptome1296Y
F021750Metagenome / Metatranscriptome217Y

Sequences

Protein IDFamilyRBSSequence
Ga0209536_1011806091F021750GAGGMQINSYRYVTLEDFVDTHELDLMDVDDILIHSKYSYGTNDDTFVGYETLCDMCNTRPLST
Ga0209536_1011806092F000325AGGAGMKVADGNDKLGKGCIVVSRPVGDTCPPCPFLGNGCYAEATERQYKNAREAGFHNIITEVARIRSMIIDAIKRNKSIRWHERGDWFIDGKLDTQYVDNVCVACESVINSGYTLPDMWFYTHIYDSTLVNKLSKYMAVYASIHNDDDMQTAKAAGFTLFAWCDSDMKIAPKRPKRKGPKRDAWHKALPKLVVLSGETFVTCPEIRKGRDFVTCTGNKNSRACNMCVNGRKNVLFPCH
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.