Scaffold Ga0208549_104168

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0208549_104168

Scaffold Ga0208549_104168

Overview

Basic Information
Taxon OID	3300027933 Open in IMG/M
Scaffold ID	Ga0208549_104168 Open in IMG/M
Source Dataset Name	Hot spring microbial mat communities from Yellowstone National Park, Wyoming, USA - BED_host_MetaG (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3394
Total Scaffold Genes	6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Extremophilic Microbial Mat Communities From Usa And Mexico

Source Dataset Sampling Location
Location Name	USA: Yellowstone National Park
Coordinates	Lat. (^o)	44.7315	Long. (^o)	-110.7113	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078331	Metagenome	116	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0208549_1041682	F078331	GGTGG	MPEKNATLVVKLHKCHIFEKAPSSISDVTKETLHEEELAKRAQGNEKFKLKKLNVDGFDAELYFDVKGMENITLGDIINLVDQVQADDKKIEASFRFV

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.