NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209298_10017534

Scaffold Ga0209298_10017534


Overview

Basic Information
Taxon OID3300027973 Open in IMG/M
Scaffold IDGa0209298_10017534 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3636
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (40.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Simoncouche, Canada
CoordinatesLat. (o)48.2311Long. (o)-71.2508Alt. (m)Depth (m)2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002162Metagenome / Metatranscriptome588Y
F007469Metagenome / Metatranscriptome350Y
F105165Metagenome / Metatranscriptome100N

Sequences

Protein IDFamilyRBSSequence
Ga0209298_100175343F105165N/AVGKGSNMTVKDDMLQLAWIFMGLGIGAWIIHEIKDTAFQNGYWKGRAHGWDSHRRLMNTKTKSDEVFDYDKN
Ga0209298_100175346F007469AGGAGGMGELQIIDGSGLTATFTDNGVKVEPSTTYCDLCNDDRLLHEGDLLRCYNCHAINRIPYHA
Ga0209298_100175347F002162N/AMPNYEYECDGEGLSIVLDLPMKHEIPCCQVCGAKLRRVYSAVPAIFKGKGWAGKGG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.