NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209299_1250814

Scaffold Ga0209299_1250814


Overview

Basic Information
Taxon OID3300027974 Open in IMG/M
Scaffold IDGa0209299_1250814 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)631
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales → unclassified Actinomycetales → Actinomycetales bacterium mxb001(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Simoncouche, Canada
CoordinatesLat. (o)48.2311Long. (o)-71.2508Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F051740Metagenome / Metatranscriptome143N
F068819Metagenome / Metatranscriptome124N

Sequences

Protein IDFamilyRBSSequence
Ga0209299_12508141F051740N/AVRDKSKLMIYVGNDPTGKAGILKKAIGNFTQEELRGWHSVNPASVSQHVIFTPEKKTYEPNKEDDSSSTEQG
Ga0209299_12508142F068819GAGMSQIKKTIQAVPNRANRNLKRNNSPLLASVTLDTSNTMLVQEDIFNEPSRERLDFTGAKWVRFFTQKDDFLKSLIAIVNNSPTLRRIIEDKVNMVVGDGFIPMKGKSNTLLTTSMKGEVITDDFLNEIEEVIGQVNLHAQNLQEVLGALAFDY
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.