NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209702_10052205

Scaffold Ga0209702_10052205


Overview

Basic Information
Taxon OID3300027976 Open in IMG/M
Scaffold IDGa0209702_10052205 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2314
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater → Freshwater Microbial Communities From Lake Liftoff Mats And Glacier Meltwater In Antarctica

Source Dataset Sampling Location
Location NameLake Fryxell, Antarctica
CoordinatesLat. (o)-77.605Long. (o)163.163Alt. (m)Depth (m)18
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001894Metagenome / Metatranscriptome621Y
F027899Metagenome / Metatranscriptome193Y
F068214Metagenome125Y

Sequences

Protein IDFamilyRBSSequence
Ga0209702_100522051F027899AGGMYQLDTPYSSQILFLNSENSVFKNIDGQGEYVYSFQTPIQLPTNCQMLISITDAQLPNIIPNVTSSNNKISFSIPTFSKLFTITLTEDDGTVDKVYNAYEWLASVNEKITYESLDQFSLYGEYHSSKIKWFCNYPFKI
Ga0209702_100522052F068214N/AMSLQHMTVKLVPQTNNVIPPGKFIYTDETFLIQPPKYVQGESFPQQGKELVPAHFSFGHINPDFTPVYSPATRMTMNYGSYIYNSVTGYQ
Ga0209702_100522054F001894AGGMNDYAKISQIHYRYQQGENKERQDKYATRKLSRLGYSLDSSNTNKDVLTATKGDKVHINYTGTNINNPRDLLSDVALGTGTQRSNPQFKQRRQKTRDIMRQYGDDKEYSLGGHSLGGSIALNTLSQSKSIRDRVKEAHVFNPGYTKLFHESIKVDKPAKKELDKKVNIHRVKGDIVSAHANKETAFGNLFEYKHEDKSSDLMDKHSLDTFIESNL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.