NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209165_10094485

Scaffold Ga0209165_10094485


Overview

Basic Information
Taxon OID3300027978 Open in IMG/M
Scaffold IDGa0209165_10094485 Open in IMG/M
Source Dataset NameMarine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1052
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment → Marine Sediment Microbial Communities From The Atlantic Coast Under Amendment With Organic Carbon And Nitrate

Source Dataset Sampling Location
Location NameAtlantic Coast
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F029110Metagenome / Metatranscriptome189N
F033812Metagenome / Metatranscriptome176N

Sequences

Protein IDFamilyRBSSequence
Ga0209165_100944851F029110N/AMNQKISELLKENASNVANSETGSKKDIGCKKEVAKAWK
Ga0209165_100944852F033812N/AMEIGKQPTEQLLEFCFKTLNKALFEMSQNKAESDRKVLANILMNDLNEKFFRLDHQEVTQAFHRGVREGEEFSINPRTWFKWLNKQKLKANKLRIENSQEGERLQIESKCQQIDKEEVLREWLEVCLVELYELHIENEKYSFVGITRVFKWLEKNNLIYISDQEKVKLFNEVQEEIVARKKFVHNKKKIFDPRIMCREKAIKKQFGKWKIAKFDLRKEIYKIIGHEPKD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.