NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0256382_1073581

Scaffold Ga0256382_1073581


Overview

Basic Information
Taxon OID3300028022 Open in IMG/M
Scaffold IDGa0256382_1073581 Open in IMG/M
Source Dataset NameSeawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)811
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-KM23-C198(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater → Extreme Environments Viral Communities From Various Locations

Source Dataset Sampling Location
Location NameMediterranean Sea
CoordinatesLat. (o)34.0321Long. (o)27.821Alt. (m)Depth (m)750
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003481Metagenome484Y
F013233Metagenome273Y

Sequences

Protein IDFamilyRBSSequence
Ga0256382_10735811F003481N/AQAREELERLKASEDKSEKIQMTSGDIVRLVIAAPVVFCWLFLGSRIIISATTSNAVLEQIEPLLLALSILTIPVTGILASLFKIDGNGK
Ga0256382_10735812F013233GGAMTLFEKICRMVGDRRIPAPRMPTFKRFSVGFANRHVTTIVVMAIMVSAAAVSVGLYFAIKDVATSTYNWPEPAEYRVTSEGLQTMGKKNEDYADGTESQTLSIRLGDGSRISTLRIKDVDLGRTGITKAFDVSPLTQAVTGATAYLWVGNLTITNSSFPTFKMETSQVANLTAGILVSLP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.