NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0247723_1001155

Scaffold Ga0247723_1001155


Overview

Basic Information
Taxon OID3300028025 Open in IMG/M
Scaffold IDGa0247723_1001155 Open in IMG/M
Source Dataset NameSubsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)15942
Total Scaffold Genes34 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (32.35%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Associated Families4

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Source Dataset Sampling Location
Location NameUSA: West Virginia
CoordinatesLat. (o)39.6017Long. (o)-79.9761Alt. (m)Depth (m)2281
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001165Metagenome / Metatranscriptome760Y
F001807Metagenome / Metatranscriptome631Y
F002985Metagenome / Metatranscriptome515Y
F051883Metagenome / Metatranscriptome143Y

Sequences

Protein IDFamilyRBSSequence
Ga0247723_100115514F001165N/AMPDNTPRIPDSIDLERLSAMQLVAKMKESADKFGIGFVGGFIAPNGEKFMMSNMSDEDTQMLLPDDLK
Ga0247723_100115518F001807GAGGMSVLLIEDTLIDGTNVTVTAVVEDMRLLYRATRYEPEEWCPALCQTTFSVDPDEQIPTDEDGFCSYLDQLDLHWQLVDTSDYAVD
Ga0247723_100115530F002985AGGLRVVWNRIASVRLSTNPMSYVIACWKNDQPFAITADVKSKQFLLIPLESEVALNKIFSHPYRAGAQQILEWINKNNAELSGQELSIQDEARFRK
Ga0247723_10011555F051883N/AMAYADLQTITLLGRIADLKSFETTDGRTCLAVTLYHRISEDAVVTVKFLNSNGLLTAFVNDNLVVGQELTVTGKIQAIRSFYMKDNELVPLKQPEFQLRVMDYAFGSKPQPKAEPKAQTKTTTKKKATPNPELVEV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.