NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0256380_1030862

Scaffold Ga0256380_1030862


Overview

Basic Information
Taxon OID3300028039 Open in IMG/M
Scaffold IDGa0256380_1030862 Open in IMG/M
Source Dataset NameSeawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 2300m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)857
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → unclassified Flavobacteriia → Flavobacteriia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater → Extreme Environments Viral Communities From Various Locations

Source Dataset Sampling Location
Location NameMediterranean Sea
CoordinatesLat. (o)34.0321Long. (o)27.821Alt. (m)Depth (m)2300
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001034Metagenome / Metatranscriptome798Y
F008820Metagenome / Metatranscriptome327Y

Sequences

Protein IDFamilyRBSSequence
Ga0256380_10308621F001034AGAAGGMLASQQVYEDAQIQSAKPIGPQAPIPPGVHDIELSWDRRKGYMRVIIEGQKYWFKEFLGKAQVLNCDNKRGRLNLRAIAQINGETLTMWRDPNAPPHEEVEGTRREKTHNRLCYRRATEEWRLRDERLDWNHPEALVFTKSYKGDLNAEWHANDSIAHIYHNGFAIIDANDVAHLYDTEL
Ga0256380_10308622F008820N/ATEKYTKMIAEITADLGKTADDLANAQNIIRALKNPDMMVNGASLTLDMVQIMENGDIRLLPPPPTPITETCVKAPEPEKNGKKPEKELVNAS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.