NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209526_10005092

Scaffold Ga0209526_10005092


Overview

Basic Information
Taxon OID3300028047 Open in IMG/M
Scaffold IDGa0209526_10005092 Open in IMG/M
Source Dataset NameForest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8966
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)14 (87.50%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location
Location NameAlgoma, Ontario, Canada
CoordinatesLat. (o)46.42Long. (o)-83.37Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F031629Metagenome / Metatranscriptome182N
F041503Metagenome / Metatranscriptome160Y

Sequences

Protein IDFamilyRBSSequence
Ga0209526_1000509213F031629AGAAGGMNARLTEVAYYRWAGALPILAPILAYLAYQDEPTLSLLDRVAIPFYVSGLVAGPAYIPFATVLFWWIRKEPAARYRALSWIAPLLFVPPFLLYLFVARWWTGSTGPLADALVFYGVMVLLVGYAYVVVIHVGRRALDRWGAIGAASAGR
Ga0209526_100050923F041503N/AMSRRATFSRRWRDLVALLAVLATGIGPVAAENRGAVPHAYYLFLADAPKGCEDCYIPLLVMQPSLEEVVSSASDTTIVLITTYERDSIWKVERGVLLAAADVSARERRVRFRDRRYRYQEVAPAEVLRLLEKPEGTIPIHRLVSAPDRKSLEDLIASFRGR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.