Basic Information | |
---|---|
Taxon OID | 3300028048 Open in IMG/M |
Scaffold ID | Ga0256405_10099144 Open in IMG/M |
Source Dataset Name | Bovine rumen microbial communities from Lethbridge, Alberta, Canada - RJG_02 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2175 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (60.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Rumen Microbial Communities From Sheep, Dairy Cows And Beef Cattle From Various Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Canada: Alberta | |||||||
Coordinates | Lat. (o) | 49.6935 | Long. (o) | -112.8418 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F041054 | Metagenome / Metatranscriptome | 160 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0256405_100991442 | F041054 | GGAGG | MTVRNCADIGVNAQYIIKRLLANQNLLKLLYYTDKDPLSHEDLTEEQIENEVFNKLIKIVPRVGPKETAHSLIVVRIARARGLASNNEFKNVSISIEVFVPMTQWIIKDTNLRPFAIMGEVQKSLNGKKIEGLGKMTGGDFSLNFLTEEISAYEQTFILTSYD |
⦗Top⦘ |