NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0268306_1003218

Scaffold Ga0268306_1003218


Overview

Basic Information
Taxon OID3300028054 Open in IMG/M
Scaffold IDGa0268306_1003218 Open in IMG/M
Source Dataset NamePhyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_15MAY2017_LD1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1035
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere → Phyllosphere Microbial Comminities From Bioenergy Crops Switchgrass And Miscanthus From Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan
CoordinatesLat. (o)42.39Long. (o)-85.37Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000255Metagenome / Metatranscriptome1449Y
F053045Metagenome / Metatranscriptome141Y

Sequences

Protein IDFamilyRBSSequence
Ga0268306_10032181F053045N/ADFMARIFALIAPVHTILHRVSCSYETIPNAPKHYATHQNMSLGSNGVDWVRSLRKIPA
Ga0268306_10032182F000255AGGMGRIGCVRCEKSQRDFVARTFALIAPVHSVLHRVSCSYETIANAPNQYATHQKMSLGSNGVDWVRS
Ga0268306_10032183F000255AGGMGWTGCVRREKSRRDFVARAFALIALVHPVLHRVSCSYETIPNAPKRYATQQNMSLGSNGVD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.