NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0255234_1176450

Scaffold Ga0255234_1176450


Overview

Basic Information
Taxon OID3300028113 Open in IMG/M
Scaffold IDGa0255234_1176450 Open in IMG/M
Source Dataset NameMetatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8h (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)560
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location
Location NameUSA: Oregon
CoordinatesLat. (o)46.1812Long. (o)-123.1834Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001488Metagenome / Metatranscriptome686Y

Sequences

Protein IDFamilyRBSSequence
Ga0255234_11764501F001488N/AMLNLKKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPSERDFLLQALYSIVISLQNNLSINFFDMWIYEIYINKVSTHNKFMSQKSQNLEPSEYITIKLAYGSSVSQDKK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.